PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0292s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 427aa    MW: 47365.7 Da    PI: 8.1393
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0292s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32244297255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0292s0037.1.p 244 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 297
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15241297IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28242297IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23244297IPR006447Myb domain, plants
PfamPF002497.7E-7245296IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPSTT KPNHTALWPH TSRSSDQEQV ADEEEDQEQS AMDLGFWNRA  60
LSNNDPSTTL SKQQTGPNPA PFNLSLSNPS IRVSSSSSLK SSNITFPHHH LLHTSSLPNP  120
NNLRHQATIV ATQNQQQQHG YMSMEPIKGI PIYHQNPARH HLPFFTASTF PHQHPSLLLD  180
SFPASLPSSI TNTNSRSNII NGGSQTCSPA ASCCQSSHHQ THHHGFLRTR FLSRFPGKKN  240
MRAPRMRWTS TLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKT  300
TDKVAASSDA YENGSSGDNA EDFTLDIHSS ARKQSDRQDQ PSIASAAGGP NALQDKNFQA  360
LWSNFLSREA WLHAGKQKDS LQGAMVSLQD MDDWRCSSIY ERSPEEIIIG RSMKKPNLEF  420
TLGRAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934916e-45AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486896e-45AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
GenBankBT0292116e-45BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898005.13e-93PREDICTED: probable transcription factor KAN2 isoform X3
SwissprotQ9C6162e-62KAN2_ARATH; Probable transcription factor KAN2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-60G2-like family protein